CD74 Monoclonal antibody

• 

  WB analysis using 66390-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 66390-1-Ig

  Ramos cells were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Daudi using 66390-1-Ig

  Daudi cells were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 66390-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CD74 antibody (66390-1-Ig, Clone: 2D8A1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CD74 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66390-1-Ig

Clone No.2D8A1

Publications(7)

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Ia antigen-associated invariant chain, HLA-DR antigens-associated invariant chain, HLADG, DHLAG, Class-II-associated invariant chain peptide

---

Tested Applications

• Positive WB detected in: Raji cells, Ramos cells, Daudi cells
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 4 publications below

Product Information

66390-1-Ig targets CD74 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25503

  Product name: Recombinant human CD74 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-48 aa of BC018726

  Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA

• Full Name: CD74 molecule, major histocompatibility complex, class II invariant chain
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC018726
• Gene Symbol: CD74
• Gene ID (NCBI): 972
• RRID: AB_2881766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04233
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Stem Cell Res Ther; DPSCs regulate epithelial-T cell interactions in oral submucous fibrosis; Authors - S Y Wang
	WB	Int Immunol; Helicobacter urease suppresses cytotoxic CD8 + T cell responses through activating Myh9-dependent induction of PD-L1.; Authors - Jian Wu
	IF	Neural Regen Res; Single-nuclei RNA sequencing uncovers heterogenous transcriptional signatures in Parkinson's disease associated with nuclear receptor-related factor 1 defect; Authors - Piniel Alphayo Kambey
human	IF	Nat Commun; Single-cell multi-omics analysis of human testicular germ cell tumor reveals its molecular features and microenvironment; Authors - Xiaojian Lu
human	WB	Am J Physiol Cell Physiol; WISP1 induces the expression of macrophage migration inhibitory factor (MIF) in human lung fibroblasts through Src kinases and EGFR-activated signaling pathways; Authors - Maria-Elpida Christopoulou
human	WB	bioRxiv; Proteomic analysis reveals the dominant effect of ipomoeassin F on the synthesis of membrane and secretory proteins in triple-negative breast cancer cells; Authors - Brihget Sicairos