Product Information
66390-1-PBS targets CD74 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species |
Full Name | CD74 molecule, major histocompatibility complex, class II invariant chain |
Calculated Molecular Weight | 34 kDa |
Observed Molecular Weight | 33 kDa |
GenBank Accession Number | BC018726 |
Gene Symbol | CD74 |
Gene ID (NCBI) | 972 |
RRID | AB_2881766 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P04233 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241).