CD74 Monoclonal antibody, PBS Only

• 

  WB analysis using 66390-1-Ig (same clone as 66390-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66390-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 66390-1-Ig (same clone as 66390-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66390-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 66390-1-Ig (same clone as 66390-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 66390-1-Ig (CD74 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66390-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Raji using 66390-1-Ig (same clone as 66390-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CD74 antibody (66390-1-Ig, Clone: 2D8A1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66390-1-PBS in a different storage buffer formulation.

CD74 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66390-1-PBS

Clone No.2D8A1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Ia antigen-associated invariant chain, HLA-DR antigens-associated invariant chain, HLADG, DHLAG, Class-II-associated invariant chain peptide

---

Product Information

66390-1-PBS targets CD74 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25503

  Product name: Recombinant human CD74 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-48 aa of BC018726

  Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA

• Full Name: CD74 molecule, major histocompatibility complex, class II invariant chain
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC018726
• Gene Symbol: CD74
• Gene ID (NCBI): 972
• RRID: AB_2881766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04233
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241).