CoraLite® Plus 488-conjugated CD74 Monoclonal antibody

CD74 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66390
Clone No.2D8A1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

2D8A1, Class-II-associated invariant chain peptide, DHLAG, HLADG, HLA-DR antigens-associated invariant chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRaji cells
Positive FC (Intra) detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66390 targets CD74 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25503

Product name: Recombinant human CD74 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-48 aa of BC018726

Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA

Predict reactive species
Full Name CD74 molecule, major histocompatibility complex, class II invariant chain
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC018726
Gene Symbol CD74
Gene ID (NCBI) 972
RRIDAB_2883326
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04233
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CD74 antibody CL488-66390Download protocol
IF protocol for CL Plus 488 CD74 antibody CL488-66390Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...