CoraLite®594-conjugated CD8a Monoclonal antibody

• 

  IF Staining of human colon cancer using CL594-66868

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite®594 CD8a antibody (CL594-66868, Clone: 1G2B10 ) at dilution of 1:200, CoraLite® Plus 488 pan-keratin antibody (CL488-26411, green), CoraLite® Plus 647 CD3 antibody (CL647-60181, Clone: 3F3A1, Magenta).

• 

  IF Staining of human tonsillitis using CL594-66868

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL594-66868 (CD8a antibody) at dilution of 1:50.

• 

  IF Staining of human tonsillitis using CL594-66868

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite®594 CD8a antibody (CL594-66868, Clone: 1G2B10 ) at dilution of 1:400. DAPI (blue).

• 

  IF Staining of human colon cancer using CL594-66868

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite® Plus 488 pan-keratin antibody (CL488-26411) at dilution of 1:200, CoraLite® Plus 647 CD3 antibody (CL647-60181, Clone: 3F3A1, Magenta) at dilution of 1:100, CoraLite®594 CD8a antibody (CL594-66868, Clone: 1G2B10, Red ) at dilution of 1:400. DAPI (Blue).

• 

  IF Staining of human colon cancer using CL594-66868

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite® Plus 488 pan-keratin antibody (CL488-26411) at dilution of 1:200, CoraLite® Plus 647 CD3 antibody (CL647-60181, Clone: 3F3A1, Cyan) at dilution of 1:100, CoraLite®594 CD8a antibody (CL594-66868, Clone: 1G2B10, Red ) at dilution of 1:400. DAPI (Blue).

CD8a Monoclonal Antibody for IF-P

Cat No. CL594-66868

Clone No.1G2B10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

Synonyms

CD8, 1G2B10, p32, MAL, Leu2

---

Tested Applications

• Positive IF-P detected in: human appendicitis tissue, human tonsillitis tissue, human colon cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66868 targets CD8a in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11111

  Product name: Recombinant human CD8A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 23-183 aa of BC025715

  Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI

• Full Name: CD8a molecule
• Calculated Molecular Weight: 235 aa, 26 kDa
• GenBank Accession Number: BC025715
• Gene Symbol: CD8A
• Gene ID (NCBI): 925
• ENSEMBL Gene ID: ENSG00000153563
• RRID: AB_2883630
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P01732
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.