Product Information
86263-1-PBS targets CD81 in WB, Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3833 Product name: Recombinant Mouse CD81 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 106-211 aa of NM_133655.2 Sequence: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV Predict reactive species |
| Full Name | CD81 antigen |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_133655.2 |
| Gene Symbol | Cd81 |
| Gene ID (NCBI) | 12520 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35762 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).

