Mouse CD81 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86263-1-RR (same clone as 86263-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86263-1-RR (CD81 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86263-1-PBS in a different storage buffer formulation.

CD81 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86263-1-PBS

Clone No.250340F7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, Tapa 1, Tapa1, Target of the antiproliferative antibody 1

---

Product Information

86263-1-PBS targets CD81 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3833

  Product name: Recombinant Mouse CD81 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 106-211 aa of NM_133655.2

  Sequence: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV

• Full Name: CD81 antigen
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_133655.2
• Gene Symbol: Cd81
• Gene ID (NCBI): 12520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35762
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).