CD81 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD81 Recombinant monoclonal antibody (86263-1-RR)

CD81 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86263-1-RR Copied!

Clone No. 250340F7

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, Tapa 1, Tapa1, Target of the antiproliferative antibody 1

• 

  WB analysis using 86263-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86263-1-RR (CD81 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 86263-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 86263-1-RR (CD81 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 86263-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 86263-1-RR (CD81 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD81 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86263-1-RR targets CD81 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3833

  Product name: Recombinant Mouse CD81 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 106-211 aa of NM_133655.2

  Sequence: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV

• Full Name: CD81 antigen
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_133655.2
• Gene Symbol: Cd81
• Gene ID (NCBI): 12520
• RRID: AB_3744763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35762
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).

Publications

What published studies show

The CD81 Recombinant monoclonal antibody (250340F7), catalog number 86263-1-RR, has a total of 1 citation. This citation appears in ACS Nano (Impact Factor 17.3), published in 2026. The study used the antibody for Western Blot in mouse samples and focused on magnetic graphene-based isolation of bone marrow mesenchymal stem cell-derived exosomes via Ca²⁺-dependent reversible recognition, placing it at the intersection of nanotechnology, exosome biology, and stem cell research.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	ACS Nano; Magnetic Graphene for High-Performance Isolation of Bone Marrow Mesenchymal Stem Cell-Derived Exosomes via Ca(2+)-Dependent Reversible Recognition.; Authors - Li He