Tested Applications
Positive FC detected in | human PBMCs |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-98202 targets CD81 in FC applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg1036 Product name: recombinant human CD81 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 113-201 aa of NM_004356.4 Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Predict reactive species |
Full Name | CD81 molecule |
Calculated Molecular Weight | 26 kDa |
GenBank Accession Number | NM_004356.4 |
Gene Symbol | CD81 |
Gene ID (NCBI) | 975 |
ENSEMBL Gene ID | ENSG00000110651 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P60033 |
Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 488 CD81 antibody CL488-98202 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |