Tested Applications
| Positive WB detected in | Daudi cells, Raji cell, Ramos cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 23 publications below |
| IHC | See 9 publications below |
| IF | See 25 publications below |
Product Information
26903-1-AP targets CD86 (C-terminal) in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25432 Product name: Recombinant human CD86 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 270-329 aa of BC040261 Sequence: WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDETQRVFKSSKTSSCDKSDTCF Predict reactive species |
| Full Name | CD86 molecule |
| Calculated Molecular Weight | 329 aa, 38 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC040261 |
| Gene Symbol | CD86 |
| Gene ID (NCBI) | 942 |
| ENSEMBL Gene ID | ENSG00000114013 |
| RRID | AB_2880677 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42081 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD86 (C-terminal) antibody 26903-1-AP | Download protocol |
| IHC protocol for CD86 (C-terminal) antibody 26903-1-AP | Download protocol |
| WB protocol for CD86 (C-terminal) antibody 26903-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Antigen Self-Presented Personalized Nanovaccines Boost the Immunotherapy of Highly Invasive and Metastatic Tumors | ||
Nat Commun A photo-triggered self-accelerated nanoplatform for multifunctional image-guided combination cancer immunotherapy | ||
Int J Oral Sci Administration of Porphyromonas gingivalis in pregnant mice enhances glycolysis and histone lactylation/ADAM17 leading to cleft palate in offspring | ||
Cell Rep Med Microneedle delivery of CAR-M-like engineered macrophages alleviates intervertebral disc degeneration through enhanced efferocytosis capacity | ||
Theranostics Multifunctionally disordered TiO2 nanoneedles prevent periprosthetic infection and enhance osteointegration by killing bacteria and modulating the osteoimmune microenvironment | ||
Int J Biol Macromol A multifunctional polydopamine/genipin/alendronate nanoparticle licences fibrin hydrogels osteoinductive and immunomodulatory potencies for repairing bone defects |





