CD9 Recombinant monoclonal antibody

• 

  IHC staining of mouse kidney using 84801-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84801-4-RR (CD9 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 84801-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84801-4-RR (CD9 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of RAW 264.7 using 84801-4-RR

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CD9 antibody (84801-4-RR, Clone: 242432C2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84801-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84801-4-RR against Mouse CD9 were performed. The affinity constant is below 1 pM.

CD9 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 84801-4-RR

Clone No.242432C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

242432C2, CD9 antigen, MIC3, P24, Tspan 29

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: RAW 264.7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84801-4-RR targets CD9 in IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1397

  Product name: Recombinant Mouse CD9 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 110-193 aa of NM_007657.3

  Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

• Full Name: CD9 antigen
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_007657.3
• Gene Symbol: Cd9
• Gene ID (NCBI): 12527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40240
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD9, also known as Tspan-29, p24 or MIC3, is a member of the tetraspanin superfamily (PMID: 1879540). It is expressed on a large variety of hematopoietic and non-hematopoietic cells, such as stromal cells, megakaryocytes, platelets, B and T lymphocytes, dendritic cells, endothelial cells, mast cells, eosinophils, and basophils (PMID: 30356731). CD9 interacts with the integrin family and other membrane proteins, and is involved in cell adhesion, cell motility and tumor metastasis (PMID: 8478605; 21428940; 25805926). Expression of CD9 enhances membrane fusion between muscle cells and supports myotube maintenance (PMID:10459022). On oocytes, CD9 is hypothesized to play a role in the fertilization of mammals (PMID: 25536312).