CoraLite® Plus 488-conjugated CD9 Recombinant monoclonal antibody

CD9 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84801-4
Clone No.242432C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

242432C2, CD9 antigen, MIC3, P24, Tspan 29

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84801-4 targets CD9 in IF/ICC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1397

Product name: Recombinant Mouse CD9 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 110-193 aa of NM_007657.3

Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

Predict reactive species
Full Name CD9 antigen
Calculated Molecular Weight25 kDa
GenBank Accession NumberNM_007657.3
Gene Symbol Cd9
Gene ID (NCBI) 12527
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP40240
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD9, also known as Tspan-29, p24 or MIC3, is a member of the tetraspanin superfamily (PMID: 1879540). It is expressed on a large variety of hematopoietic and non-hematopoietic cells, such as stromal cells, megakaryocytes, platelets, B and T lymphocytes, dendritic cells, endothelial cells, mast cells, eosinophils, and basophils (PMID: 30356731). CD9 interacts with the integrin family and other membrane proteins, and is involved in cell adhesion, cell motility and tumor metastasis (PMID: 8478605; 21428940; 25805926). Expression of CD9 enhances membrane fusion between muscle cells and supports myotube maintenance (PMID:10459022). On oocytes, CD9 is hypothesized to play a role in the fertilization of mammals (PMID: 25536312).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD9 antibody CL488-84801-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...