Anti-Mouse CD9 Rabbit Recombinant Antibody

• 

  FC experiment of mouse bone marrow cells using 98270-1-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD9 Rabbit Recombinant Antibody (98270-1-RR, Clone: 242432C7) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Mouse Ly-6G/Ly-6C (Gr-1). Cells were not fixed.

• 

  FC experiment of mouse bone marrow cells using 98270-1-RR

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD9 Rabbit Recombinant Antibody (98270-1-RR, Clone: 242432C7)(red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98270-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98270-1-RR against Mouse CD9 were performed. The affinity constant is 0.26 nM.

CD9 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98270-1-RR

Clone No.242432C7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

242432C7, CD9 antigen, MIC3, P24, Tspan 29

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98270-1-RR targets CD9 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1397

  Product name: Recombinant Mouse CD9 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 110-193 aa of NM_007657.3

  Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

• Full Name: CD9 antigen
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_007657.3
• Gene Symbol: Cd9
• Gene ID (NCBI): 12527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40240
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).