Product Information
CL488-66766 targets CD90 in applications and shows reactivity with Human, pig, rat samples.
| Tested Reactivity | Human, pig, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
| Full Name | Thy-1 cell surface antigen |
| Calculated Molecular Weight | 161 aa, 18 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC065559 |
| Gene Symbol | CD90/Thy1 |
| Gene ID (NCBI) | 7070 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04216 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
