CoraLite® Plus 488-conjugated CD90 Monoclonal antibody

CD90 Monoclonal Antibody for
Cat No. CL488-66766
Clone No.2D7D11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, pig, rat

Applications

CD90, CDw90, FLJ33325, Thy 1 antigen, Thy 1 cell surface antigen, Thy 1 membrane glycoprotein, THY1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66766 targets CD90 in applications and shows reactivity with Human, pig, rat samples.

Tested Reactivity Human, pig, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25603

Product name: Recombinant human CD90 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-80 aa of BC065559

Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF

Predict reactive species
Full Name Thy-1 cell surface antigen
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC065559
Gene Symbol CD90/Thy1
Gene ID (NCBI) 7070
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04216
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Loading...
||
New chat Able
正在加载,请稍候...