CoraLite® Plus 488-conjugated CD90 Recombinant monoclonal antibody

CD90 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84206-3
Clone No.241388E2

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

IF/ICC

241388E2, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84206-3 targets CD90 in IF/ICC applications and shows reactivity with rat samples.

Tested Reactivity rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1463

Product name: Recombinant Rat CD90/Thy1 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-130 aa of NM_012673.2

Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC

Predict reactive species
Full Name Thy-1 cell surface antigen
Calculated Molecular Weight18 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_012673.2
Gene Symbol Thy1
Gene ID (NCBI) 24832
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01830
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD90 antibody CL488-84206-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...