CD93 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01683-3

  Sandwich ELISA standard curve of MP01683-3, Human CD93 Recombinant Matched Antibody Pair - PBS only. 84945-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2794. 84945-3-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP01683-3

  Serum of six individual healthy human donors was measured. The CD93 concentration of detected samples was determined to be 204.8 pg/mL with a range of 163.5-256.8 pg/mL.

• 

  Sample test of MP01683-3

  Plasma of six individual healthy human donors was measured. The CD93 concentration of detected samples was determined to be 221.7 pg/mL with a range of 185.4-264.8 pg/mL.

• 

  Sample test of MP01683-3

  Urine of six individual healthy human donors was measured. The CD93 concentration of detected samples was determined to be 1,768.1 pg/mL with a range of 340.0-3,778.7 pg/mL.

• 

  Sample test of MP01683-3

  Saliva of six individual healthy human donors was measured. The CD93 concentration of detected samples was determined to be 776.7 pg/mL with a range of 273.6-1,280.6 pg/mL.

• 

  Sample test of MP01683-3

  HUVEC and THP-1 cells were cultured in DMEM supplemented with 10% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin and 100 μg/mL streptomycin sulfate, respectively. Aliquots of the cell culture supernate were removed, assayed for human CD93, and measured 9,051.4 pg/mL and 406.3 pg/mL, respectively.

CD93 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84945-2-PBS

Clone No.242464G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

C1QR1, C1qR, C1qR(p), C1qRp, Matrix-remodeling-associated protein 4

---

Product Information

84945-2-PBS targets CD93 as part of a matched antibody pair:

MP01683-3: 84945-2-PBS capture and 84945-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2794

  Product name: Recombinant Human CD93 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-580 aa of NM_012072.3

  Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK

• Full Name: CD93 molecule
• Calculated Molecular Weight: 69 kDa
• GenBank Accession Number: NM_012072.3
• Gene Symbol: CD93
• Gene ID (NCBI): 22918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPY3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.