Tested Applications
| Positive WB detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-60354 targets CD99 in WB applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19474 Product name: Recombinant human CD99 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-115 aa of BC021620 Sequence: LSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHR Predict reactive species |
| Full Name | CD99 molecule |
| Calculated Molecular Weight | 19 kDa, 16 kDa, 17 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC021620 |
| Gene Symbol | CD99 |
| Gene ID (NCBI) | 4267 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P14209 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD99, also known as MIC2, is a heavily O-glycosylated transmembrane protein involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. CD99 is broadly distributed on many cell types, with particularly strong expression on human cortical thymocytes, Ewing's sarcoma cells and peripheral primitive neuroectodermal tumors (PMID: 9794396; 16984917). In normal cells, CD99 has been functionally implicated in cell adhesion, migration, apoptosis, differentiation, activation, and proliferation of lymphocytes and monocyte extravasation and transport of several transmembrane proteins (PMID: 16984917). CD99 displays two surface isoforms generated by alternative splicing: a long 32 kDa and a short 28 kDa form (PMID: 12368226).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CL Plus 750 CD99 antibody CL750-60354 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

