CoraLite® Plus 750-conjugated CD99 Monoclonal antibody

CD99 Monoclonal Antibody for WB
Cat No. CL750-60354
Clone No.5B6A4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB

12E7, 5B6A4, CD99 antigen, CD99 molecule, E2 antigen

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-60354 targets CD99 in WB applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19474

Product name: Recombinant human CD99 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 28-115 aa of BC021620

Sequence: LSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHR

Predict reactive species
Full Name CD99 molecule
Calculated Molecular Weight 19 kDa, 16 kDa, 17 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC021620
Gene Symbol CD99
Gene ID (NCBI) 4267
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP14209
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD99, also known as MIC2, is a heavily O-glycosylated transmembrane protein involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. CD99 is broadly distributed on many cell types, with particularly strong expression on human cortical thymocytes, Ewing's sarcoma cells and peripheral primitive neuroectodermal tumors (PMID: 9794396; 16984917). In normal cells, CD99 has been functionally implicated in cell adhesion, migration, apoptosis, differentiation, activation, and proliferation of lymphocytes and monocyte extravasation and transport of several transmembrane proteins (PMID: 16984917). CD99 displays two surface isoforms generated by alternative splicing: a long 32 kDa and a short 28 kDa form (PMID: 12368226).

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 CD99 antibody CL750-60354Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...