CDA Polyclonal antibody

• 

  WB analysis using 28579-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28579-1-AP (CDA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using 28579-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CDA (28579-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

CDA Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 28579-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

CDD, Cytidine aminohydrolase, cytidine deaminase

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

28579-1-AP targets CDA in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29507

  Product name: Recombinant human CDA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-146 aa of NM_001785

  Sequence: LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ

• Full Name: cytidine deaminase
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_001785
• Gene Symbol: CDA
• Gene ID (NCBI): 978
• RRID: AB_2881174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32320
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; m6A Methyltransferase METTL14-Mediated Upregulation of Cytidine Deaminase Promoting Gemcitabine Resistance in Pancreatic Cancer.; Authors - Congjun Zhang
human	WB,IHC	Cancer Lett; Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer; Authors - Minghua Bai