Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
28579-1-AP targets CDA in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29507 Product name: Recombinant human CDA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-146 aa of NM_001785 Sequence: LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ Predict reactive species |
Full Name | cytidine deaminase |
Calculated Molecular Weight | 16 kDa |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | NM_001785 |
Gene Symbol | CDA |
Gene ID (NCBI) | 978 |
RRID | AB_2881174 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P32320 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDA antibody 28579-1-AP | Download protocol |
FC protocol for CDA antibody 28579-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Oncol m6A Methyltransferase METTL14-Mediated Upregulation of Cytidine Deaminase Promoting Gemcitabine Resistance in Pancreatic Cancer. | ||
Cancer Lett Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer |