CDC26 Polyclonal antibody

• 

  WB analysis using 14125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14125-1-AP (CDC26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 14125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14125-1-AP (CDC26 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 14125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14125-1-AP (CDC26 Antibody) at dilution of 1:50 (under 10x lens).

CDC26 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14125-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ANAPC12, APC12, C9orf17, CDC26

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

14125-1-AP targets CDC26 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5276

  Product name: Recombinant human CDC26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC066300

  Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

• Full Name: cell division cycle 26 homolog (S. cerevisiae)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC066300
• Gene Symbol: CDC26
• Gene ID (NCBI): 246184
• RRID: AB_2878018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHZ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex/cyclosome (APC/C). CDC26 can be detected as 14 kDa and ~18 kDa (PMID: 15060174 /PMID: 10222126).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites.; Authors - Kyungsoo Ha
mouse	WB,IF	Am J Obstet Gynecol; Homozygous missense variations of APC12 cause meiotic metaphase I arrest in oocytes and female infertility; Authors - Yunying Lin