CDC26 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDC26 Polyclonal antibody (14125-1-AP)

CDC26 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14125-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ANAPC12, APC12, C9orf17, CDC26

• 

  WB analysis using 14125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14125-1-AP (CDC26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14125-1-AP (CDC26 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14125-1-AP (CDC26 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDC26 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14125-1-AP targets CDC26 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5276

  Product name: Recombinant human CDC26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC066300

  Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF

• Full Name: cell division cycle 26 homolog (S. cerevisiae)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC066300
• Gene Symbol: CDC26
• Gene ID (NCBI): 246184
• RRID: AB_2878018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHZ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex/cyclosome (APC/C). CDC26 can be detected as 14 kDa and ~18 kDa (PMID: 15060174 /PMID: 10222126).

Publications

What published studies show

The CDC26 Polyclonal antibody (Cat# 14125-1-AP) has 3 published citations. These appear in Nature Communications, American Journal of Obstetrics and Gynecology, and Clinical and Experimental Medicine. The associated research fields include DNA damage repair and anaphase promoting complex signaling, meiotic arrest and female infertility, and ferroptosis via SLC7A11 degradation and cell cycle regulation. Applications cited include IF, WB, and IP in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Commun; The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites.; Authors - Kyungsoo Ha
mouse	WB,IF	Am J Obstet Gynecol; Homozygous missense variations of APC12 cause meiotic metaphase I arrest in oocytes and female infertility; Authors - Yunying Lin
human	WB,IP	Clin Exp Med; CDC26 facilitates ferroptosis through SLC7A11 degradation and cell cycle arrest.; Authors - Junhao Lin