Tested Applications
Positive WB detected in | HeLa cells |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 2 publications below |
Product Information
14125-1-AP targets CDC26 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5276 Product name: Recombinant human CDC26 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC066300 Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF Predict reactive species |
Full Name | cell division cycle 26 homolog (S. cerevisiae) |
Calculated Molecular Weight | 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC066300 |
Gene Symbol | CDC26 |
Gene ID (NCBI) | 246184 |
RRID | AB_2878018 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NHZ8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex/cyclosome (APC/C). CDC26 can be detected as 14 kDa and ~18 kDa (PMID: 15060174 /PMID: 10222126).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDC26 antibody 14125-1-AP | Download protocol |
IHC protocol for CDC26 antibody 14125-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites. | ||
Am J Obstet Gynecol Homozygous missense variations of APC12 cause meiotic metaphase I arrest in oocytes and female infertility |