Tested Applications
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-81373-10 targets CDKN2A/P16-INK4A in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 2A |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC021998 |
| Gene Symbol | CDKN2A |
| Gene ID (NCBI) | 1029 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42771 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 CDKN2A/P16-INK4A antibody CL488-81373-10 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
