Product Information
85162-4-PBS targets CDS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29228 Product name: Recombinant human CDS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC025751 Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR Predict reactive species |
| Full Name | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 |
| Calculated Molecular Weight | 445 aa, 51 kDa |
| Observed Molecular Weight | 50-51 kDa |
| GenBank Accession Number | BC025751 |
| Gene Symbol | CDS2 |
| Gene ID (NCBI) | 8760 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95674 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





