CEACAM16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CEACAM16 Polyclonal antibody, PBS Only (32196-1-PBS)

• 

  WB analysis using 32196-1-AP (same clone as 32196-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32196-1-AP (CEACAM16 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 32196-1-AP (same clone as 32196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 32196-1-AP (CEACAM16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 32196-1-AP (same clone as 32196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 32196-1-AP (CEACAM16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32196-1-PBS in a different storage buffer formulation.

CEACAM16 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32196-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Carcinoembryonic Antigen Related Cell Adhesion Molecule 16, Carcinoembryonic antigen-like 2, Carcinoembryonic antigen-related cell adhesion molecule 16, CEA Cell Adhesion Molecule 16, Tectorial Membrane Component , DFNA4B

---

Product Information

32196-1-PBS targets CEACAM16 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37542

  Product name: Recombinant human CEACAM16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 295-425 aa of BC156855

  Sequence: AKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 16
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC156855
• Gene Symbol: CEACAM16
• Gene ID (NCBI): 388551
• RRID: AB_3742541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q2WEN9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16) is a member of the CEA family of cell adhesion molecules. It is a critical component of the tectorial membrane in the inner ear, playing a significant role in maintaining hearing function. Mutations in the CEACAM16 gene are associated with autosomal dominant nonsyndromic hearing loss (DFNA4B), characterized by progressive high-frequency hearing impairment. Research has shown that loss or dysfunction of CEACAM16 leads to structural abnormalities in the tectorial membrane, thereby affecting hearing. The identification of CEACAM16 has provided important insights into the genetic basis of hereditary hearing loss and has implications for the diagnosis and treatment of hearing disorders.