CEACAM16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CEACAM16 Polyclonal antibody (32196-1-AP)

• 

  WB analysis using 32196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32196-1-AP (CEACAM16 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human urothelial carcinoma using 32196-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 32196-1-AP (CEACAM16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 32196-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 32196-1-AP (CEACAM16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CEACAM16 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32196-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Carcinoembryonic Antigen Related Cell Adhesion Molecule 16, Carcinoembryonic antigen-like 2, Carcinoembryonic antigen-related cell adhesion molecule 16, CEA Cell Adhesion Molecule 16, Tectorial Membrane Component , DFNA4B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human placenta tissue, human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32196-1-AP targets CEACAM16 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37542

  Product name: Recombinant human CEACAM16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 295-425 aa of BC156855

  Sequence: AKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 16
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC156855
• Gene Symbol: CEACAM16
• Gene ID (NCBI): 388551
• RRID: AB_3742541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q2WEN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16) is a member of the CEA family of cell adhesion molecules. It is a critical component of the tectorial membrane in the inner ear, playing a significant role in maintaining hearing function. Mutations in the CEACAM16 gene are associated with autosomal dominant nonsyndromic hearing loss (DFNA4B), characterized by progressive high-frequency hearing impairment. Research has shown that loss or dysfunction of CEACAM16 leads to structural abnormalities in the tectorial membrane, thereby affecting hearing. The identification of CEACAM16 has provided important insights into the genetic basis of hereditary hearing loss and has implications for the diagnosis and treatment of hearing disorders.