Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® CoraLite® Plus 488 Anti-Human CEACAM8/CD66b Rabbit Recombinant Antibody

CEACAM8/CD66b FcZero-rAb® Recombinant Antibody for FC

Cat No. CL488-FcA98507-2
Clone No.242954D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD66b, CEACAM8, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CD 66b

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman peripheral blood leukocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-FcA98507-2 targets CEACAM8/CD66b in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg32133

Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 35-319 aa of BC026263

Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

Predict reactive species
Full Name carcinoembryonic antigen-related cell adhesion molecule 8
Calculated Molecular Weight 38 kDa
GenBank Accession NumberBC026263
Gene Symbol CEACAM8
Gene ID (NCBI) 1088
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP31997
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CEACAM8/CD66b antibody CL488-FcA98507-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...