Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 3 publications below |
Product Information
28142-1-AP targets CENPE in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27230 Product name: Recombinant human CENPE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2401-2500 aa of NM_001286734 Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR Predict reactive species |
Full Name | centromere protein E, 312kDa |
Calculated Molecular Weight | 316 kDa |
Observed Molecular Weight | 300-316 kDa |
GenBank Accession Number | NM_001286734 |
Gene Symbol | CENPE |
Gene ID (NCBI) | 1062 |
RRID | AB_2881072 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q02224 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CENPE antibody 28142-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biochim Biophys Acta Mol Cell Res Kinesin-7 CENP-E is essential for chromosome alignment and spindle assembly of mouse spermatocytes. | ||
Am J Transl Res Kinesin family members KIF2C/4A/10/11/14/18B/20A/23 predict poor prognosis and promote cell proliferation in hepatocellular carcinoma. | ||
PLoS One CENPE expression is associated with its DNA methylation status in esophageal adenocarcinoma and independently predicts unfavorable overall survival. | ||
Cell Mol Life Sci Global phosphoproteomic analysis identified key kinases regulating male meiosis in mouse | ||
Transl Oncol A pan-cancer landscape of centromere proteins in tumorigenesis and anticancer drug sensitivity | ||
J Cancer Development and Validation of the novel Cuproptosis- and Immune-related Signature for Predicting Prognosis in Hepatocellular Carcinoma |