CENPE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CENPE Polyclonal antibody (28142-1-AP)

CENPE Polyclonal Antibody for WB, ELISA

Cat No. 28142-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

Kinesin 7, CENP E, Centromere associated protein E, Centromere protein E, Kinesin related protein CENPE

• 

  WB analysis using 28142-1-AP

  HEK-293 cells lysate were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 28142-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 28142-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 28142-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CENPE in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28142-1-AP targets CENPE in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27230

  Product name: Recombinant human CENPE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2401-2500 aa of NM_001286734

  Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR

• Full Name: centromere protein E, 312kDa
• Calculated Molecular Weight: 316 kDa
• Observed Molecular Weight: 300-316 kDa
• GenBank Accession Number: NM_001286734
• Gene Symbol: CENPE
• Gene ID (NCBI): 1062
• RRID: AB_2881072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Centromeric protein E (CENPE) is also named Kinesin-7. CENPE, a member of the centromere protein (CENP) family, functions as a microtubule plus-end directed motor protein that is upregulated during the G2 phase (PMID: 31115500, PMID: 7851898, PMID: 38560520). It plays a crucial role in the spindle assembly checkpoint (SAC), chromosome alignment, and microtubule capture at kinetochores during mitosis (PMID: 30784092). CENPE is essential for mitotic white matter, which accumulates during the G2 phase of the cell cycle, is consumed throughout mitosis and degrades later in the cell cycle (PMID: 33862458). CENPE regulates the cell cycle by targeting the transcription of CDK1 in the nucleus (PMID: 33862458). Studies on tumor cells have shown that CENPE plays an important role in the regulation of cell proliferation, apoptosis, migration and other activities (PMID: 33862458).

Publications

What published studies show

The CENPE antibody (Cat# 28142-1-AP) has 11 total citations published across 10 journals including Cell Death & Disease, Cancer Cell International, Cellular and Molecular Life Sciences, Translational Oncology, Biochimica et Biophysica Acta, Journal of Cancer, Current Research in Translational Medicine, PLoS One, IET Systems Biology, and American Journal of Translational Research. Research fields span oncology (cervical, endometrial, breast, hepatocellular, esophageal, colorectal cancers, and multiple myeloma), cell division/chromosome biology, and phosphoproteomics.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Death Dis; M(5)C-driven stabilization of SERPINB5 promotes cervical cancer progression and chemotherapy resistance.; Authors - Jiejie Liu
human	IHC	Cancer Cell Int; Characterization of G2/M checkpoint classifier for personalized treatment in uterine corpus endometrial carcinoma; Authors - Yiming Liu
		Cancer Cell Int; PSMD8 promotes breast cancer progression and attenuates paclitaxel sensitivity by stabilizing KIF10.; Authors - Chenyuan Li
mouse	WB	Cell Mol Life Sci; Global phosphoproteomic analysis identified key kinases regulating male meiosis in mouse; Authors - Haojie Li
human	IHC	Transl Oncol; A pan-cancer landscape of centromere proteins in tumorigenesis and anticancer drug sensitivity; Authors - Yuan-Xiang Shi
mouse	WB	Biochim Biophys Acta Mol Cell Res; Kinesin-7 CENP-E is essential for chromosome alignment and spindle assembly of mouse spermatocytes.; Authors - Zhen-Yu She