CENPE Polyclonal antibody

• 

  WB analysis using 28142-1-AP

  HEK-293 cells lysate were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 28142-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 28142-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 28142-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 28142-1-AP (CENPE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CENPE Polyclonal Antibody for WB, ELISA

Cat No. 28142-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, ELISA

Synonyms

CENP E, CENPE, Centromere protein E, centromere protein E, 312kDa, KIF10, Kinesin related protein CENPE

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 3 publications below

Product Information

28142-1-AP targets CENPE in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27230

  Product name: Recombinant human CENPE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2401-2500 aa of NM_001286734

  Sequence: MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR

• Full Name: centromere protein E, 312kDa
• Calculated Molecular Weight: 316 kDa
• Observed Molecular Weight: 300-316 kDa
• GenBank Accession Number: NM_001286734
• Gene Symbol: CENPE
• Gene ID (NCBI): 1062
• RRID: AB_2881072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biochim Biophys Acta Mol Cell Res; Kinesin-7 CENP-E is essential for chromosome alignment and spindle assembly of mouse spermatocytes.; Authors - Zhen-Yu She
human	WB	Am J Transl Res; Kinesin family members KIF2C/4A/10/11/14/18B/20A/23 predict poor prognosis and promote cell proliferation in hepatocellular carcinoma.; Authors - Xishan Li
human	IHC	PLoS One; CENPE expression is associated with its DNA methylation status in esophageal adenocarcinoma and independently predicts unfavorable overall survival.; Authors - Xueqiang Zhu
mouse	WB	Cell Mol Life Sci; Global phosphoproteomic analysis identified key kinases regulating male meiosis in mouse; Authors - Haojie Li
human	IHC	Transl Oncol; A pan-cancer landscape of centromere proteins in tumorigenesis and anticancer drug sensitivity; Authors - Yuan-Xiang Shi
human	WB	J Cancer; Development and Validation of the novel Cuproptosis- and Immune-related Signature for Predicting Prognosis in Hepatocellular Carcinoma; Authors - Yongping Zhang