Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CEP164 Polyclonal antibody

CEP164 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22227-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, canine and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

3F2B7, CEP 164, KIAA1052, centrosomal protein 164kDa, NPHP15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells
Positive IP detected inRPE1 cells
Positive IHC detected inhuman colon tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, A549 cells, PC-3 cells, MDCK cells, hTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22227-1-AP targets CEP164 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Cited Reactivityhuman, mouse, xenopus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17570

Product name: Recombinant human CEP164 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-112 aa of BC000602

Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK

Predict reactive species
Full Name centrosomal protein 164kDa
Calculated Molecular Weight 1460 aa, 164 kDa
Observed Molecular Weight 164 kDa
GenBank Accession NumberBC000602
Gene Symbol CEP164
Gene ID (NCBI) 22897
RRIDAB_2651175
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UPV0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEP164, also called KIAA1052 or NPHP15, is a 1460 amino acid protein containing 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in the G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.

Protocols

Product Specific Protocols
IF protocol for CEP164 antibody 22227-1-APDownload protocol
IHC protocol for CEP164 antibody 22227-1-APDownload protocol
WB protocol for CEP164 antibody 22227-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Res

NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis.

Authors - Min Liu

Nat Commun

Sub-centrosomal mapping identifies augmin-γTuRC as part of a centriole-stabilizing scaffold.

Authors - Nina Schweizer
humanIF

Nat Commun

M-Phase Phosphoprotein 9 regulates ciliogenesis by modulating CP110-CEP97 complex localization at the mother centriole.

Authors - Ning Huang

Nat Commun

Genetic link between renal birth defects and congenital heart disease.

Authors - Jovenal T San Agustin
humanWB

Nat Commun

DNA replication licensing factor Cdc6 and Plk4 kinase antagonistically regulate centrosome duplication via Sas-6.

Authors - Xiaowei Xu
humanIF

EMBO J

ANKRD26 recruits PIDD1 to centriolar distal appendages to activate the PIDDosome following centrosome amplification.

Authors - Lauren T Evans

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ludovic (Verified Customer) (02-27-2024)

A fabulous antibody to identify the distal appendage of the primary cilium. Never seen an antibody that works so well!

  • Applications: Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human cell line
FH

Elisa (Verified Customer) (04-04-2023)

H9 cells stained for Hoechst (DNA marker, in green), Cep164 (mother centriole distal appendage marker, in green) and g-Tubulin (pericentriolar matrix marker, in magenta). H9 cells were fixed in cold methanol for 10' at -20C. Cells were then rehydrated with PBS for 5'. Membrane permeabilization was then performed with 0.1% Triton + 0.1% Tween +0.01%SDS in PBS for 5'. Cells were finally incubated with blocking buffer (5% BSA+ 0.1% Tween in PBS) for 30' at RT. Primary antibody was diluted in blocking buffer 1:300 and incubated for 1h at room temperature. Alexa-488-Anti-rabbit was used as secondary antibody (1:600 dilution) (1h at room temperature).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: H9 cells
CEP164 Antibody Immunofluorescence validation (1:300 dilution) in H9 cells (Cat no:22227-1-AP)
FH

Pierrick (Verified Customer) (10-24-2019)

Great antibody for immunofluorescence on human cells.Works well in WB

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: CEP164 IF 1/1000 to 1/2000 and WB 1/1000
  • Cell Tissue Type: RPE1, HEK290, HeLa Kyoto
Loading...
||
New chat

Able

正在加载,请稍候...