Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IP detected in | RPE1 cells |
| Positive IHC detected in | human colon tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, A549 cells, PC-3 cells, MDCK cells, hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22227-1-AP targets CEP164 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Cited Reactivity | human, mouse, xenopus |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17570 Product name: Recombinant human CEP164 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000602 Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK Predict reactive species |
| Full Name | centrosomal protein 164kDa |
| Calculated Molecular Weight | 1460 aa, 164 kDa |
| Observed Molecular Weight | 164 kDa |
| GenBank Accession Number | BC000602 |
| Gene Symbol | CEP164 |
| Gene ID (NCBI) | 22897 |
| RRID | AB_2651175 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPV0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CEP164, also called KIAA1052 or NPHP15, is a 1460 amino acid protein containing 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in the G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CEP164 antibody 22227-1-AP | Download protocol |
| IHC protocol for CEP164 antibody 22227-1-AP | Download protocol |
| WB protocol for CEP164 antibody 22227-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CEP164 Polyclonal antibody (Cat# 22227-1-AP) has accumulated 100 citations in high-impact journals including Science, Cell, Nature Communications, EMBO Journal, Current Biology, Developmental Cell, Journal of Cell Biology, eLife, PNAS, and Cell Reports. The associated research fields primarily cover ciliogenesis, centriole and centrosome biology, intraflagellar transport, Hedgehog signaling, cell cycle regulation, ciliary-related diseases such as Joubert syndrome, and microtubule organization.
| Species | Application | Title |
|---|---|---|
Cell SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming | ||
Cell Time-series reconstruction of the molecular architecture of human centriole assembly | ||
Cell Unraveling cellular complexity with transient adapters in highly multiplexed super-resolution imaging | ||
Cell Res NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis. | ||
Nat Commun High-resolution characterization of centriole distal appendage morphology and dynamics by correlative STORM and electron microscopy. |
Reviews
What customers say
All three reviews rate this antibody 5 stars. Users consistently report excellent performance in immunofluorescence on human cell lines (H9, RPE1, HEK290, HeLa), with clear labeling of the mother centriole distal appendage. One reviewer described it as a "fabulous antibody" for identifying the distal appendage of the primary cilium. Western blot results were also well received at 1:1000 dilution. Recommended dilutions range from 1:300 to 1:2000 for IF and 1:1000 for WB. Overall, reviewers highlight strong specificity, reliable signal, and ease of use across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ludovic (Verified Customer) (02-27-2024) | A fabulous antibody to identify the distal appendage of the primary cilium. Never seen an antibody that works so well!
|
Elisa (Verified Customer) (04-04-2023) | H9 cells stained for Hoechst (DNA marker, in green), Cep164 (mother centriole distal appendage marker, in green) and g-Tubulin (pericentriolar matrix marker, in magenta). H9 cells were fixed in cold methanol for 10' at -20C. Cells were then rehydrated with PBS for 5'. Membrane permeabilization was then performed with 0.1% Triton + 0.1% Tween +0.01%SDS in PBS for 5'. Cells were finally incubated with blocking buffer (5% BSA+ 0.1% Tween in PBS) for 30' at RT. Primary antibody was diluted in blocking buffer 1:300 and incubated for 1h at room temperature. Alexa-488-Anti-rabbit was used as secondary antibody (1:600 dilution) (1h at room temperature).
 |
Pierrick (Verified Customer) (10-24-2019) | Great antibody for immunofluorescence on human cells.Works well in WB
|
