Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-22227 targets CEP164 in IF/ICC applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17570 Product name: Recombinant human CEP164 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000602 Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK Predict reactive species |
| Full Name | centrosomal protein 164kDa |
| Calculated Molecular Weight | 1460 aa, 164 kDa |
| Observed Molecular Weight | 164 kDa |
| GenBank Accession Number | BC000602 |
| Gene Symbol | CEP164 |
| Gene ID (NCBI) | 22897 |
| RRID | AB_2919194 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPV0 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CEP164, also named as KIAA1052 or NPHP15, is a 1460 amino acid protein, which contains 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 CEP164 antibody CL488-22227 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

