• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated CEP164 Polyclonal antibody

CEP164 Polyclonal Antibody for IF/ICC
Cat No. CL594-22227

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

IF/ICC

KIAA1052, CEP 164, 3F2B7, NPHP15, centrosomal protein 164kDa

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-22227 targets CEP164 in IF/ICC applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17570

Product name: Recombinant human CEP164 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-112 aa of BC000602

Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK

Predict reactive species
Full Name centrosomal protein 164kDa
Calculated Molecular Weight 1460 aa, 164 kDa
Observed Molecular Weight 164 kDa
GenBank Accession NumberBC000602
Gene Symbol CEP164
Gene ID (NCBI) 22897
RRIDAB_2919869
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UPV0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CEP164, also named as KIAA1052 or NPHP15, is a 1460 amino acid protein, which contains 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.

Protocols

Product Specific Protocols
IF protocol for CL594 CEP164 antibody CL594-22227Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...