CoraLite®594-conjugated CEP164 Polyclonal antibody

• 

  IF Staining of HeLa using CL594-22227

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 CEP164 antibody (CL594-22227) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CEP164 Polyclonal Antibody for IF/ICC

Cat No. CL594-22227

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

IF/ICC

Synonyms

KIAA1052, CEP 164, 3F2B7, NPHP15, centrosomal protein 164kDa

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-22227 targets CEP164 in IF/ICC applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17570

  Product name: Recombinant human CEP164 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC000602

  Sequence: MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK

• Full Name: centrosomal protein 164kDa
• Calculated Molecular Weight: 1460 aa, 164 kDa
• Observed Molecular Weight: 164 kDa
• GenBank Accession Number: BC000602
• Gene Symbol: CEP164
• Gene ID (NCBI): 22897
• RRID: AB_2919869
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPV0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CEP164, also named as KIAA1052 or NPHP15, is a 1460 amino acid protein, which contains 1 WW domain. CEP164 localizes in the microtubule organizing center and is expressed in several cell lines. CEP164 plays a role in microtubule organization and/or maintenance for the formation of primary cilia, a microtubule-based structure that protrudes from the surface of epithelial cells. CEP164 plays a critical role in G2/M checkpoint and nuclear divisions. The expression of CEP164 is normally limited to the mother centriole, and CEP164 can be used as a useful marker for mother centriole.