CEPT1 Polyclonal antibody

• 

  IHC staining of human pancreas using 20496-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 20496-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cervical cancer using 20496-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 20496-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 20496-1-AP (CEPT1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse liver using 20496-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20496-1-AP (CEPT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 20496-1-AP

  Immunofluorescent analysis of HepG2 cells, using CEPT1 antibody 20496-1-AP at 1:25 dilution and FITC- labeled goat anti-Rabbit IgG (green).

• Featured Product
• KD/KO Validated

CEPT1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20496-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CEPT1, hCEPT1

---

Tested Applications

• Positive IHC detected in: mouse liver tissue, human pancreas tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IF: See 5 publications below

Product Information

20496-1-AP targets CEPT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14140

  Product name: Recombinant human CEPT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC032610

  Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII

• Full Name: choline/ethanolamine phosphotransferase 1
• Calculated Molecular Weight: 416 aa, 47 kDa
• GenBank Accession Number: BC032610
• Gene Symbol: CEPT1
• Gene ID (NCBI): 10390
• RRID: AB_10694283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6K0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Protein Cell; Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis; Authors - Xiaoguang Liu ; KO Validated
human	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
human,mouse	WB,IF	Diabetes; CEPT1-Mediated Phospholipogenesis Regulates Endothelial Cell Function and Ischemia-Induced Angiogenesis Through PPARα.; Authors - Mohamed A Zayed ; KO Validated
human	IF	J Lipid Res; Diabetes Adversely Affects Phospholipid Profiles in Human Carotid Artery Endarterectomy Plaques.; Authors - Mohamed A Zayed
human,mouse	WB	J Agric Food Chem; Inhibitory Effects of Peroxidase from Foxtail Millet Bran on Colitis-Associated Colorectal Carcinogenesis by the Blockage of Glycerophospholipid Metabolism.; Authors - Shuhua Shan
human	IF	Hepatol Commun; Dysregulation of lipid metabolism in the pseudolobule promotes region-specific autophagy in hepatitis B liver cirrhosis; Authors - Wenjun Pu