Tested Applications
Positive IHC detected in | mouse liver tissue, human cervical cancer tissue, human pancreas tissue, human tonsillitis tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 4 publications below |
Product Information
20496-1-AP targets CEPT1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14140 Product name: Recombinant human CEPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032610 Sequence: MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLITII Predict reactive species |
Full Name | choline/ethanolamine phosphotransferase 1 |
Calculated Molecular Weight | 416 aa, 47 kDa |
GenBank Accession Number | BC032610 |
Gene Symbol | CEPT1 |
Gene ID (NCBI) | 10390 |
RRID | AB_10694283 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y6K0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Choline-enthanolamine phosphotransferase 1 (CEPT1) is a 47-kDa membrane-bound protein that catalyzes the terminal step of the Kennedy pathway. CEPT1 is encoded by the Cept1 gene and is responsible for phosphatidylcholine (PC) and phosphatidylethanolamine (PE) production (PMID: 33214136, 30030520).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CEPT1 antibody 20496-1-AP | Download protocol |
IF protocol for CEPT1 antibody 20496-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Protein Cell Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis | ||
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. | ||
J Lipid Res Diabetes Adversely Affects Phospholipid Profiles in Human Carotid Artery Endarterectomy Plaques. | ||
Hepatol Commun Dysregulation of lipid metabolism in the pseudolobule promotes region-specific autophagy in hepatitis B liver cirrhosis | ||
J Hazard Mater YTHDC2 mediated RNA m6A modification contributes to PM2.5-induced hepatic steatosis |