CERK Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 25731-1-AP (same clone as 25731-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25731-1-AP (CERK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 25731-1-AP (same clone as 25731-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25731-1-AP (CERK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25731-1-AP (same clone as 25731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25731-1-AP (CERK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25731-1-AP (same clone as 25731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25731-1-AP (CERK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 25731-1-AP (same clone as 25731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25731-1-AP (CERK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 25731-1-AP (same clone as 25731-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25731-1-AP (CERK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25731-1-PBS in a different storage buffer formulation.

CERK Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25731-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25731-1-PBS targets CERK in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22774

  Product name: Recombinant human CERK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 224-537 aa of BC126940

  Sequence: AVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS

• Full Name: ceramide kinase
• Calculated Molecular Weight: 537 aa, 60 kDa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC126940
• Gene Symbol: CERK
• Gene ID (NCBI): 64781
• RRID: AB_2880214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCT0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ceramide kinase (CERK) is a crucial lipid kinase that specifically catalyses ceramide (CER) to ceramide-1-phosphate. It plays a vital role in biological functions and certain diseases, including aberrant wound healing (PMID: 24823941), obesity-diabetes (PMID: 22465662), mesangio-proliferativekidney diseases (PMID: 25134723), cancer (PMID: 25164007) and neuroblastoma (PMID: 22579669). CERK has 2 isoforms with the molecular weight of 60 and 38 kDa.