Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | mouse skeletal muscle tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10394-1-AP targets CFLAR/FLIP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0593 Product name: Recombinant human CFLAR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-184 aa of BC001602 Sequence: DVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRN Predict reactive species |
| Full Name | CASP8 and FADD-like apoptosis regulator |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 20-35 kDa, 50-55 kDa |
| GenBank Accession Number | BC001602 |
| Gene Symbol | FLIP |
| Gene ID (NCBI) | 8837 |
| RRID | AB_2081087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CFLAR, also named CASH, CASP8AP1, CLARP, MRIT, Casper, c-FLIP, and I-FLICE, belongs to the peptidase C14A family. It is an apoptosis regulator protein that may function as a crucial link between cell survival and cell death pathways in mammalian cells. CFLAR acts as an inhibitor of TNFRSF6-mediated apoptosis. It can be cleaved to be 2 fragments P43 and P12. P43 is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full-length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. CFLAR lacks enzymatic (caspase) activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CFLAR/FLIP antibody 10394-1-AP | Download protocol |
| IHC protocol for CFLAR/FLIP antibody 10394-1-AP | Download protocol |
| IP protocol for CFLAR/FLIP antibody 10394-1-AP | Download protocol |
| WB protocol for CFLAR/FLIP antibody 10394-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CFLAR/FLIP (c-FLIP) polyclonal antibody (Cat# 10394-1-AP) has 13 citations. Journals include Cancer Research, Cell Death & Differentiation, Cell Death & Disease, Biomedical Pharmacotherapy, European Journal of Pharmacology, Chemical Biology & Interactions, Molecular Medicine Reports, Journal of Cellular and Molecular Medicine, Thoracic Cancer, Biochemical and Biophysical Research Communications, Oncology Letters, and International Journal of Biological Sciences. Research fields span cancer biology (colon, lung, thyroid, lymphoma), apoptosis, necroptosis, pyroptosis, autophagy, and metabolic signaling.
| Species | Application | Title |
|---|---|---|
Cancer Res DAB2IP is a bifunctional tumor suppressor that regulates wildtype RAS and inflammatory cascades in KRAS mutant colon cancer | ||
Cell Death Differ Coordinated repression of BIM and PUMA by Epstein-Barr virus latent genes maintains the survival of Burkitt lymphoma cells. | ||
Cell Death Dis Cellular FLICE-like inhibitory protein (cFLIP) critically maintains apoptotic resistance in human lens epithelial cells.
| ||
Biomed Pharmacother 20(S/R)-ginsenoside Rh1 improves type 2 diabetes via gut microbiota-modulated bile acid signaling and FXR/TGR5-dependent GLP-1 enhancement. | ||
Eur J Pharmacol Y320 suppresses non-small cell lung cancer growth by triggering autophagy-dependent pyroptosis through ubiquitin/proteasome-mediated c-FLIP degradation. | ||
Chem Biol Interact Hsa_circ_0005050 interacts with ILF3 and affects cell apoptosis and proliferation by disrupting the balance between p53 and p65 |
