CoraLite® Plus 488-conjugated CFLAR/FLIP Polyclonal antibody

• 

  IF Staining of HeLa using CL488-10394

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 CFLAR/FLIP antibody (CL488-10394) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CFLAR/FLIP Polyclonal Antibody for IF/ICC

Cat No. CL488-10394

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

c FLIP, c FLIPL, c FLIPR, c FLIPS, CASH, CASP8AP1, Caspase eight related protein, Caspase homolog, Casper, CFLAR, CLARP, FLAME, FLAME 1, FLAME1, FLIP, I FLICE, Inhibitor of FLICE, MRIT, Usurpin

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10394 targets CFLAR/FLIP in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0593

  Product name: Recombinant human CFLAR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-184 aa of BC001602

  Sequence: DVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRN

• Full Name: CASP8 and FADD-like apoptosis regulator
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 20-35 kDa, 50-55 kDa
• GenBank Accession Number: BC001602
• Gene Symbol: FLIP
• Gene ID (NCBI): 8837
• RRID: AB_3672439
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15519
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CFLAR, also named CASH, CASP8AP1, CLARP, MRIT, Casper, c-FLIP, and I-FLICE, belongs to the peptidase C14A family. It is an apoptosis regulator protein that may function as a crucial link between cell survival and cell death pathways in mammalian cells. CFLAR acts as an inhibitor of TNFRSF6-mediated apoptosis. It can be cleaved to be 2 fragments P43 and P12. P43 is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full-length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. CFLAR lacks enzymatic (caspase) activity.