CFTR Monoclonal antibody, PBS Only

• 

  WB analysis using 66928-1-Ig (same clone as 66928-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66928-1-Ig (CFTR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66928-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66928-1-Ig (same clone as 66928-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66928-1-Ig (CFTR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66928-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66928-1-Ig (same clone as 66928-1-PBS)

  WB result of CFTR antibody (66928-1-Ig; 1:4000; room temperature for 1.5 hours) with wild-type and CFTR knockout HEK-293T cells. This data was developed using the same antibody clone with 66928-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66928-1-Ig (same clone as 66928-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66928-1-Ig (CFTR antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66928-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 66928-1-Ig (same clone as 66928-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66928-1-Ig (CFTR antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66928-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CFTR Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66928-1-PBS

Clone No.2F4A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, ELISA

Synonyms

Channel conductance-controlling ATPase, CFTR/MRP, cAMP-dependent chloride channel, ATP-binding cassette sub-family C member 7, ABCC7

---

Product Information

66928-1-PBS targets CFTR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27810

  Product name: Recombinant human CFTR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-80 aa of NM_000492

  Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR

• Full Name: cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7)
• Calculated Molecular Weight: 168 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: NM_000492
• Gene Symbol: CFTR
• Gene ID (NCBI): 1080
• RRID: AB_2882254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13569
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CFTR is a member of the ATP-binding cassette (ABC) family of membrane transport proteins, functioning as a chloride channel responsible for ion flow across epithelial surfaces of lung, sinuses, pancreas, intestine, and liver. Mutations of CFTR cause cystic fibrosis (CF), a disorder affecting the respiratory, digestive, reproductive systems and sweat glands.