Product Information
66928-1-PBS targets CFTR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.
Tested Reactivity | human, mouse, rat, rabbit |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27810 Product name: Recombinant human CFTR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-80 aa of NM_000492 Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR Predict reactive species |
Full Name | cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) |
Calculated Molecular Weight | 168 kDa |
Observed Molecular Weight | 150 kDa |
GenBank Accession Number | NM_000492 |
Gene Symbol | CFTR |
Gene ID (NCBI) | 1080 |
RRID | AB_2882254 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P13569 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CFTR is a member of the ATP-binding cassette (ABC) family of membrane transport proteins, functioning as a chloride channel responsible for ion flow across epithelial surfaces of lung, sinuses, pancreas, intestine, and liver. Mutations of CFTR cause cystic fibrosis (CF), a disorder affecting the respiratory, digestive, reproductive systems and sweat glands.