Tested Applications
Positive WB detected in | Calu-3 cells, HEK-293T cells, HeLa cells, HT-29 cells, Caco-2 cells, MCF-7 cells, MOLT-4 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue, A431 cells, A375 cells, A549 cells, NCI-H1299 cells, HepG2 cells |
Positive IHC detected in | human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
66928-1-Ig targets CFTR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.
Tested Reactivity | human, mouse, rat, rabbit |
Cited Reactivity | mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27810 Product name: Recombinant human CFTR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-80 aa of NM_000492 Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR Predict reactive species |
Full Name | cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) |
Calculated Molecular Weight | 168 kDa |
Observed Molecular Weight | 150 kDa |
GenBank Accession Number | NM_000492 |
Gene Symbol | CFTR |
Gene ID (NCBI) | 1080 |
RRID | AB_2882254 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P13569 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CFTR is a member of the ATP-binding cassette (ABC) family of membrane transport proteins, functioning as a chloride channel responsible for ion flow across epithelial surfaces of lung, sinuses, pancreas, intestine, and liver. Mutations of CFTR cause cystic fibrosis (CF), a disorder affecting the respiratory, digestive, reproductive systems and sweat glands.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CFTR antibody 66928-1-Ig | Download protocol |
IHC protocol for CFTR antibody 66928-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |