CoraLite® Plus 488-conjugated CGGBP1 Monoclonal antibody

• 

  FC experiment of HeLa using CL488-66524

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human CGGBP1 (CL488-66524, Clone:2F5G9) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

CGGBP1 Monoclonal Antibody for FC (Intra)

Cat No. CL488-66524

Clone No.2F5G9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, mouse

Applications

FC (Intra)

Synonyms

20 kDa CGG binding protein, CGG binding protein 1, CGGBP, CGGBP1, p20 CGGBP, p20 CGGBP DNA binding protein

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66524 targets CGGBP1 in FC (Intra) applications and shows reactivity with Human, Rat, mouse samples.

• Tested Reactivity: Human, Rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1129

  Product name: Recombinant human CGGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC005222

  Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC

• Full Name: CGG triplet repeat binding protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC005222
• Gene Symbol: CGGBP1
• Gene ID (NCBI): 8545
• RRID: AB_2934474
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UFW8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)