CoraLite® Plus 488-conjugated CGGBP1 Monoclonal antibody

CGGBP1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-66524
Clone No.2F5G9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, mouse

Applications

FC (Intra)

20 kDa CGG binding protein, CGG binding protein 1, CGGBP, CGGBP1, p20 CGGBP, p20 CGGBP DNA binding protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66524 targets CGGBP1 in FC (Intra) applications and shows reactivity with Human, Rat, mouse samples.

Tested Reactivity Human, Rat, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1129

Product name: Recombinant human CGGBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-167 aa of BC005222

Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC

Predict reactive species
Full Name CGG triplet repeat binding protein 1
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC005222
Gene Symbol CGGBP1
Gene ID (NCBI) 8545
RRIDAB_2934474
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UFW8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CGGBP1 antibody CL488-66524Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...