CGGBP1 Monoclonal antibody

• 

  WB analysis using 66524-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66524-1-Ig (CGGBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of NIH/3T3 using 66524-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66524-1-Ig (CGGBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

CGGBP1 Monoclonal Antibody for WB, ELISA

Cat No. 66524-1-Ig

Clone No.2F5G9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, mouse

Applications

WB, ELISA

Synonyms

20 kDa CGG binding protein, CGG binding protein 1, CGGBP, CGGBP1, p20 CGGBP, p20 CGGBP DNA binding protein

---

Tested Applications

• Positive WB detected in: MCF-7 cells, NIH/3T3 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66524-1-Ig targets CGGBP1 in WB, ELISA applications and shows reactivity with Human, Rat, mouse samples.

• Tested Reactivity: Human, Rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1129

  Product name: Recombinant human CGGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC005222

  Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC

• Full Name: CGG triplet repeat binding protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC005222
• Gene Symbol: CGGBP1
• Gene ID (NCBI): 8545
• RRID: AB_2881887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UFW8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)