CH25H Polyclonal antibody

• 

  IP experiment of mouse liver using 16734-1-AP

  IP result of anti-CH25H (IP:16734-1-AP, 4ug; Detection:16734-1-AP 1:300) with mouse liver tissue lysate 5200ug.

• 

  IHC staining of mouse liver using 16734-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16734-1-AP (CH25H Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 16734-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16734-1-AP (CH25H Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CH25H Polyclonal Antibody for IP, IHC, ELISA

Cat No. 16734-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, ELISA

Synonyms

C25H, CH25H, cholesterol 25 hydroxylase, Cholesterol 25 monooxygenase, h25OH

---

Tested Applications

• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16734-1-AP targets CH25H in IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9706

  Product name: Recombinant human CH25H protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 140-272 aa of BC017843

  Sequence: FVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

• Full Name: cholesterol 25-hydroxylase
• Calculated Molecular Weight: 272 aa, 32 kDa
• GenBank Accession Number: BC017843
• Gene Symbol: CH25H
• Gene ID (NCBI): 9023
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95992
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.