CHCHD1 Polyclonal antibody

• 

  WB analysis of A431 using 11728-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 11728-1-AP (CHCHD1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 11728-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11728-1-AP (CHCHD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 11728-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A431 cells using 11728-1-AP (CHCHD1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of A431 using 11728-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.25 ug CHCHD1 Polyclonal antibody (11728-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CHCHD1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 11728-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

28S ribosomal protein S37, mitochondrial, C10orf34, Coiled-coil-helix-coiled-coil-helix domain-containing protein 1, MRPS37, MRP-S37

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11728-1-AP targets CHCHD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2325

  Product name: Recombinant human CHCHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC020852

  Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 1
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC020852
• Gene Symbol: CHCHD1
• Gene ID (NCBI): 118487
• RRID: AB_2079769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		iScience; Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation; Authors - Taru Hilander
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia