CHCHD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CHCHD1 Polyclonal antibody (11728-1-AP)

CHCHD1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 11728-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

28S ribosomal protein S37, mitochondrial, C10orf34, Coiled-coil-helix-coiled-coil-helix domain-containing protein 1, MRPS37, MRP-S37

• 

  WB analysis of A431 using 11728-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 11728-1-AP (CHCHD1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 11728-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11728-1-AP (CHCHD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 11728-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A431 cells using 11728-1-AP (CHCHD1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A431 using 11728-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.25 ug CHCHD1 Polyclonal antibody (11728-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CHCHD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11728-1-AP targets CHCHD1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2325

  Product name: Recombinant human CHCHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC020852

  Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 1
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC020852
• Gene Symbol: CHCHD1
• Gene ID (NCBI): 118487
• RRID: AB_2079769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CHCHD1 Polyclonal antibody (Cat# 11728-1-AP) has 3 citations published in Nature Structural & Molecular Biology, iScience, and Immun Inflamm Dis. The research fields span human mitochondrial ribosome assembly and translation, as well as linking mitochondrial dysfunction to the immune microenvironment in heart failure with preserved ejection fraction (HFpEF).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia
		iScience; Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation; Authors - Taru Hilander
mouse	IHC	Immun Inflamm Dis; Linking Mitochondrial Dysfunction to the Immune Microenvironment in HFpEF: An Integrated Bioinformatics and Experimental Approach.; Authors - Yingying Xie