Tested Applications
| Positive WB detected in | HEK-293 cells, mouse brain tissue, HAP1, mouse heart tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue, HAP1 cells |
| Positive IHC detected in | human kidney tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HAP1 |
| Positive CoIP detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Co-Immunoprecipitation (CoIP) | COIP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 20 publications below |
| IHC | See 3 publications below |
| IF | See 9 publications below |
| IP | See 1 publications below |
Product Information
25671-1-AP targets CHCHD10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 10 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC065232 |
| Gene Symbol | CHCHD10 |
| Gene ID (NCBI) | 400916 |
| RRID | AB_2880187 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WYQ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHCHD10 antibody 25671-1-AP | Download protocol |
| IHC protocol for CHCHD10 antibody 25671-1-AP | Download protocol |
| IP protocol for CHCHD10 antibody 25671-1-AP | Download protocol |
| WB protocol for CHCHD10 antibody 25671-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun TDP-43 and PINK1 mediate CHCHD10S59L mutation-induced defects in Drosophila and in vitro. | ||
Nat Commun Loss of function CHCHD10 mutations in cytoplasmic TDP-43 accumulation and synaptic integrity.
| ||
J Mol Cell Biol Single-cell transcriptomes reveal molecular specializations of neuronal cell types in the developing cerebellum. | ||
Diabetes CHCHD10 Modulates Thermogenesis of Adipocytes by Regulating Lipolysis
| ||
Mol Ther Nucleic Acids Modulation of miR-181 influences dopaminergic neuronal degeneration in a mouse model of Parkinson's disease. | ||
Hum Mol Genet Loss of CHCHD10-CHCHD2 complexes required for respiration underlies the pathogenicity of a CHCHD10 mutation in ALS.
|































