• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CHCHD10 Polyclonal antibody

CHCHD10 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-25671

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

CoraLite® Plus 488-conjugated CHCHD10 Polyclonal antibody, C22orf16, Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial, N27C7 4, Protein N27C7 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-25671 targets CHCHD10 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22598

Product name: Recombinant human CHCHD10 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 82-142 aa of BC065232

Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 10
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC065232
Gene Symbol CHCHD10
Gene ID (NCBI) 400916
RRIDAB_3084092
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WYQ3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CHCHD10 antibody CL488-25671Download protocol
IF protocol for CL Plus 488 CHCHD10 antibody CL488-25671Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Int Immunopharmacol

Curcumin prevents neurodegeneration by blocking HDAC6-NLRP3 pathway-dependent neuroinflammation in Parkinson's disease

Authors - Ziwei Cai
Loading...
||
New chat Able
正在加载,请稍候...