Tested Applications
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-66584 targets CHCHD5 in IF/ICC applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22534 Product name: Recombinant human CHCHD5 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species |
Full Name | coiled-coil-helix-coiled-coil-helix domain containing 5 |
Calculated Molecular Weight | 110 aa, 12 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC004498 |
Gene Symbol | CHCHD5 |
Gene ID (NCBI) | 84269 |
RRID | AB_2923920 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9BSY4 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 CHCHD5 antibody CL594-66584 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |