CHCHD7 Polyclonal antibody, PBS Only

• 

  WB analysis using 19911-1-AP (same clone as 19911-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19911-1-AP (CHCHD7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19911-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 19911-1-AP (same clone as 19911-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 19911-1-AP (CHCHD7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 19911-1-AP (same clone as 19911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 19911-1-AP (CHCHD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 19911-1-AP (same clone as 19911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 19911-1-AP (CHCHD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19911-1-PBS in a different storage buffer formulation.

CHCHD7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19911-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Coiled-coil-helix-coiled-coil-helix domain-containing protein 7

---

Product Information

19911-1-PBS targets CHCHD7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13735

  Product name: Recombinant human CHCHD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC002546

  Sequence: MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 7
• Calculated Molecular Weight: 97 aa, 12 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC002546
• Gene Symbol: CHCHD7
• Gene ID (NCBI): 79145
• RRID: AB_10666734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.