CHCHD7 Polyclonal antibody

CHCHD7 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 19911-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Coiled-coil-helix-coiled-coil-helix domain-containing protein 7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue, human placenta tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19911-1-AP targets CHCHD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13735

Product name: Recombinant human CHCHD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC002546

Sequence: MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 7
Calculated Molecular Weight 97 aa, 12 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC002546
Gene Symbol CHCHD7
Gene ID (NCBI) 79145
RRIDAB_10666734
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BUK0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CHCHD7 antibody 19911-1-APDownload protocol
WB protocol for CHCHD7 antibody 19911-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...