CHRM3 Polyclonal antibody, PBS Only

• 

  WB analysis using 21978-1-AP (same clone as 21978-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21978-1-AP (CHRM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21978-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21978-1-AP (same clone as 21978-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21978-1-AP (CHRM3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21978-1-AP (same clone as 21978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21978-1-AP (CHRM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21978-1-AP (same clone as 21978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21978-1-AP (CHRM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21978-1-PBS in a different storage buffer formulation.

CHRM3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21978-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HM3

---

Product Information

21978-1-PBS targets CHRM3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17791

  Product name: Recombinant human CHRM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-477 aa of BC121026

  Sequence: RTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITK

• Full Name: cholinergic receptor, muscarinic 3
• Calculated Molecular Weight: 590 aa, 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC121026
• Gene Symbol: CHRM3
• Gene ID (NCBI): 1131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20309
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHRM3 (M3 muscarinic acetylcholine receptor) is a major player in many kinds of cancer (PMID: 26175851). The expression of muscarinic receptors, mainly the CHRM3, is amplified in several types of tumors, including colon cancer, prostate cancer, endometrial carcinoma, and gastric cancer. Colon cancer overexpresses CHRM3, and post-M3R signaling promotes cell growth via the activation of the epidermal growth factor receptors/ERK and protein kinase C/p38 mitogen-activated protein kinase (MAPK) signaling pathways (PMID: 37744266).