CHT1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 21848-1-AP (same clone as 21848-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21848-1-AP (CHT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21848-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 21848-1-AP (same clone as 21848-1-PBS)

  IP result of anti-CHT1 (IP:21848-1-AP, 4ug; Detection:21848-1-AP 1:500) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 21848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 21848-1-AP (same clone as 21848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21848-1-AP (CHT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 21848-1-AP (same clone as 21848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21848-1-AP (CHT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 21848-1-AP (same clone as 21848-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CHT1 antibody (21848-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21848-1-PBS in a different storage buffer formulation.

CHT1 Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 21848-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

Synonyms

SLC5A7, Hemicholinium-3-sensitive choline transporter, hCHT1, hCHT, CHT

---

Product Information

21848-1-PBS targets CHT1 in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16136

  Product name: Recombinant human SLC5A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 457-580 aa of BC111525

  Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ

• Full Name: solute carrier family 5 (choline transporter), member 7
• Calculated Molecular Weight: 580 aa, 63 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC111525
• Gene Symbol: CHT1
• Gene ID (NCBI): 60482
• RRID: AB_2878925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZV3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.