CHT1 Polyclonal antibody

• 

  WB analysis of mouse brain using 21848-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21848-1-AP (CHT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 21848-1-AP

  IP result of anti-CHT1 (IP:21848-1-AP, 4ug; Detection:21848-1-AP 1:500) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of rat brain using 21848-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21848-1-AP (CHT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 21848-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 21848-1-AP (CHT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 21848-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CHT1 antibody (21848-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CHT1 Polyclonal Antibody for WB, IF-P, IP, ELISA

Cat No. 21848-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

SLC5A7, Hemicholinium-3-sensitive choline transporter, hCHT1, hCHT, CHT

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse heart tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

21848-1-AP targets CHT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16136

  Product name: Recombinant human SLC5A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 457-580 aa of BC111525

  Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ

• Full Name: solute carrier family 5 (choline transporter), member 7
• Calculated Molecular Weight: 580 aa, 63 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC111525
• Gene Symbol: CHT1
• Gene ID (NCBI): 60482
• RRID: AB_2878925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZV3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Mol Metab; Activation of a non-neuronal cholinergic system in visceral white adipose tissue of obese mice and humans; Authors - Ilenia Severi
mouse	IHC	Adv Sci (Weinh); CircFBXW4 Suppresses Colorectal Cancer Progression by Regulating the MiR-338-5p/SLC5A7 Axis; Authors - Wei Song