Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
21848-1-AP targets CHT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16136 Product name: Recombinant human SLC5A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 457-580 aa of BC111525 Sequence: QPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ Predict reactive species |
| Full Name | solute carrier family 5 (choline transporter), member 7 |
| Calculated Molecular Weight | 580 aa, 63 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC111525 |
| Gene Symbol | CHT1 |
| Gene ID (NCBI) | 60482 |
| RRID | AB_2878925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZV3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHT1 antibody 21848-1-AP | Download protocol |
| IHC protocol for CHT1 antibody 21848-1-AP | Download protocol |
| IP protocol for CHT1 antibody 21848-1-AP | Download protocol |
| WB protocol for CHT1 antibody 21848-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol Multi-omics reveal the neuroprotective mechanisms of Xinshubao tablet against scopolamine-induced cognitive dysfunction in mice | ||
Mol Metab Activation of a non-neuronal cholinergic system in visceral white adipose tissue of obese mice and humans | ||
Adv Sci (Weinh) CircFBXW4 Suppresses Colorectal Cancer Progression by Regulating the MiR-338-5p/SLC5A7 Axis |









