Tested Applications
| Positive WB detected in | mouse skin tissue, HeLa cells, mouse liver tissue |
| Positive IHC detected in | human brain tissue, human gliomas tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12247-1-AP targets CHURC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2892 Product name: Recombinant human CHURC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC020550 Sequence: MCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF Predict reactive species |
| Full Name | churchill domain containing 1 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC020550 |
| Gene Symbol | CHURC1 |
| Gene ID (NCBI) | 91612 |
| RRID | AB_10666204 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WUH1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHURC1 (churchill domain containing 1), also known as C14orf52 or chch. The function of CHURC1 has not been widely studied, and is yet to be fully elucidated. It may be a transcriptional activator that mediates FGF signaling during neural development.The MW of this protein is 13 kDa, and Catalog#12247-1-AP specially recognises the 13 kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CHURC1 antibody 12247-1-AP | Download protocol |
| IHC protocol for CHURC1 antibody 12247-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















