Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, Jurkat cells, K-562 cells, mouse brain tissue, mouse liver tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
Product Information
12638-1-AP targets CIAPIN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3333 Product name: Recombinant human CIAPIN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-312 aa of BC024196 Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA Predict reactive species |
| Full Name | cytokine induced apoptosis inhibitor 1 |
| Calculated Molecular Weight | 312 aa, 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC024196 |
| Gene Symbol | CIAPIN1 |
| Gene ID (NCBI) | 57019 |
| RRID | AB_2079665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6FI81 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The cytokine-induced anti-apoptotic molecule (CIAPIN1, or DRE2) had been found to be a differentially-expressed gene involved in a variety of cancers, and it was also considered as a candidate tumor suppressor gene in gastric cancer, renal cancer and liver cancer. CIAPIN1 plays an important role in the differentiation of colorectal cancer (CRC) cells, and the differential expression of CIAPIN1 in CRC was closely related to prognosis. CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a valuable prognostic indicator in esophageal squamous cell carcinoma (ESCC).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CIAPIN1 antibody 12638-1-AP | Download protocol |
| IHC protocol for CIAPIN1 antibody 12638-1-AP | Download protocol |
| WB protocol for CIAPIN1 antibody 12638-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Hum Mol Genet Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients. | ||
ACS Chem Neurosci Proteomic Study on the Mechanism of Arsenic Neurotoxicity in the Rat Cerebral Cortex and the Protective Mechanism of Dictyophora Polysaccharides against Arsenic Neurotoxicity | ||
Front Oncol Downregulation of miR-142a Contributes to the Enhanced Anti-Apoptotic Ability of Murine Chronic Myelogenous Leukemia Cells. | ||
Sci Adv Autophagy supports mitochondrial metabolism through the regulation of iron homeostasis in pancreatic cancer | ||
Haematologica Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis. | ||
J Clin Invest CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes |









