CKAP4 Polyclonal antibody

• 

  WB analysis using 16686-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16686-1-AP (CKAP4 antibody) at dilution of 1:60000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16686-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16686-1-AP (CKAP4 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat kidney using 16686-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 16686-1-AP (CKAP4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16686-1-AP

  IP result of anti-CKAP4 (IP:16686-1-AP, 4ug; Detection:16686-1-AP 1:1000) with HeLa cells lysate 2000ug.

• 

  IHC staining of human kidney using 16686-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16686-1-AP (CKAP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16686-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 16686-1-AP (CKAP4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 16686-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 16686-1-AP (CKAP4 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 16686-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16686-1-AP (CKAP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16686-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CKAP4 antibody (16686-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 16686-1-AP

  Immunofluorescent analysis of HepG2 cells, using CKAP4 antibody 16686-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of U2OS using 16686-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CKAP4 antibody (16686-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

CKAP4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16686-1-AP

Publications(52)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

63 kDa membrane protein, CLIMP 63, Climp-63, ERGIC 63, p63

---

Tested Applications

• Positive WB detected in: A431 cells, rat kidney tissue, HeLa cells, HepG2 cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 32 publications below
• IHC: See 4 publications below
• IF: See 19 publications below
• IP: See 4 publications below
• CoIP: See 3 publications below

Product Information

16686-1-AP targets CKAP4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10019

  Product name: Recombinant human CKAP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-602 aa of BC082972

  Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

• Full Name: cytoskeleton-associated protein 4
• Calculated Molecular Weight: 602 aa, 66 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC082972
• Gene Symbol: CKAP4
• Gene ID (NCBI): 10970
• RRID: AB_2276275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07065
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKAP4, also named as Climp-63, is a 63 kDa cytoskeleton-linking membrane protein. It is the partner of triadin. CKAP4 is responsible for this association of triads and microtubules. It functions as a key structural component, tethering the ER to the microtubule cytoskeleton and thereby regulating ER network morphology and dynamics. Beyond its structural role, CKAP4 has been identified as a multifunctional signaling receptor present on the plasma membrane for various ligands, including tissue plasminogen activator, anti-proliferative factor, and DICKKOPF1 (DKK1). This dual localization enables CKAP4 to participate in diverse cellular processes such as cell proliferation, migration, and immune modulation. Its dysregulation is implicated in several pathological conditions, including cancers, fibrosis, and inflammatory diseases, highlighting its significance as a potential therapeutic target and biomarker.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Regulation of endoplasmic reticulum turnover by selective autophagy.; Authors - Aliaksandr Khaminets
rat	WB	Cell Metab; Palmitoylation couples insulin hypersecretion with β cell failure in diabetes; Authors - Guifang Dong
human	WB	Nat Cell Biol; Combinatorial selective ER-phagy remodels the ER during neurogenesis; Authors - Melissa J Hoyer
human	WB,CoIP	Nat Commun; Parvimonas micra promotes oral squamous cell carcinoma metastasis through TmpC-CKAP4 axis; Authors - Houbao Qi
human	WB	Nat Commun; AMFR-mediated Flavivirus NS2A ubiquitination subverts ER-phagy to augment viral pathogenicity; Authors - Linliang Zhang
human	WB	Mol Cell; Quality Control of ER Membrane Proteins by the RNF185/Membralin Ubiquitin Ligase Complex; Authors - Michael L van de Weijer

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Audrey (Verified Customer) (11-12-2025)

Antibody gave good signal with low backgound in brain sections fixed with 4% PFA.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Brain

FH

udesh (Verified Customer) (06-25-2025)

worked well at 1:2000 for MSCs

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: MSCs

FH

WEI (Verified Customer) (06-28-2020)

Single strong band at correct size.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: Mouse Heart