CoraLite® Plus 488-conjugated CKAP4 Polyclonal antibody

CKAP4 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-16686

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

p63, ERGIC 63, Climp-63, CLIMP 63, 63 kDa membrane protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16686 targets CKAP4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10019

Product name: Recombinant human CKAP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 254-602 aa of BC082972

Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

Predict reactive species
Full Name cytoskeleton-associated protein 4
Calculated Molecular Weight 602 aa, 66 kDa
Observed Molecular Weight 63 kDa
GenBank Accession NumberBC082972
Gene Symbol CKAP4
Gene ID (NCBI) 10970
RRIDAB_2919140
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07065
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CKAP4, also named as Climp-63, is a 63 kDa cytoskeleton-linking membrane protein. It is the partner of triadin. CKAP4 is responsible for this association of triads and microtubules.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CKAP4 antibody CL488-16686Download protocol
FC protocol for CL Plus 488 CKAP4 antibody CL488-16686Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...