CoraLite® Plus 647-conjugated CKAP4 Recombinant monoclonal antibody

CKAP4 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL647-84485-4
Clone No.241871B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

241871B6, 63 kDa membrane protein, CLIMP 63, Climp-63, ERGIC 63

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-84485-4 targets CKAP4 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10022

Product name: Recombinant human CKAP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 254-602 aa of BC082972

Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

Predict reactive species
Full Name cytoskeleton-associated protein 4
Calculated Molecular Weight 602 aa, 66 kDa
Observed Molecular Weight 63 kDa
GenBank Accession NumberBC082972
Gene Symbol CKAP4
Gene ID (NCBI) 10970
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07065
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CKAP4 (Cytoskeleton-associated protein 4), also known as CLIMP-63 (cytoskeleton-linking membrane protein 63), is a 63 kDa cytoskeleton-linking membrane protein. CKAP4 is a novel DKK1-binding protein on the cell surface membrane of Madin-Darby canine kidney (MDCK) epithelial cells, and evaluated CKAP4-mediated DKK1 signaling in cancer cell proliferation (PMID: 27322059). In addition, CKAP4 was modified with palmitate at Cys100 by palmitoyl acyltransferase DHHC2 (PMID: 18296695), and palmitoylation was required for CKAP4 localization to PM lipid rafts to promote cancer cell proliferation (PMID: 31744930).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 CKAP4 antibody CL647-84485-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...