CKAP4 Recombinant monoclonal antibody

• 

  WB analysis using 84485-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84485-4-RR (CKAP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 84485-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CKAP4 antibody (84485-4-RR, Clone: 241871B6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 84485-4-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CKAP4 antibody (84485-4-RR, Clone: 241871B6 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 84485-4-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CKAP4 Recombinant antibody (84485-4-RR, Clone:241871B6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of U2OS using 84485-4-RR

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug CKAP4 Recombinant antibody (84485-4-RR, Clone:241871B6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84485-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84485-4-RR against Human CKAP4 were performed. The affinity constant is 2.71 nM.

CKAP4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 84485-4-RR

Clone No.241871B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

241871B6, 63 kDa membrane protein, CLIMP 63, Climp-63, ERGIC 63

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, HepG2 cells, A549 cells
• Positive IF/ICC detected in: HepG2 cells, U2OS cells
• Positive FC (Intra) detected in: HeLa cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84485-4-RR targets CKAP4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10022

  Product name: Recombinant human CKAP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 254-602 aa of BC082972

  Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

• Full Name: cytoskeleton-associated protein 4
• Calculated Molecular Weight: 602 aa, 66 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC082972
• Gene Symbol: CKAP4
• Gene ID (NCBI): 10970
• RRID: AB_3672002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q07065
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKAP4 (Cytoskeleton-associated protein 4), also known as CLIMP-63 (cytoskeleton-linking membrane protein 63), is a 63 kDa cytoskeleton-linking membrane protein. CKAP4 is a novel DKK1-binding protein on the cell surface membrane of Madin-Darby canine kidney (MDCK) epithelial cells, and evaluated CKAP4-mediated DKK1 signaling in cancer cell proliferation (PMID: 27322059). In addition, CKAP4 was modified with palmitate at Cys100 by palmitoyl acyltransferase DHHC2 (PMID: 18296695), and palmitoylation was required for CKAP4 localization to PM lipid rafts to promote cancer cell proliferation (PMID: 31744930).